PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P21300_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 516aa    MW: 54550.7 Da    PI: 6.9025
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P21300_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS213.41.2e-652003891195
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            lv++L++cAeav++++l++a+al++++s la++++ pm+++a yf+eA+a+r++r    l++  ++ +++    ++ l+    f+e +
  GSMUA_Achr1P21300_001 200 LVHALMACAEAVQQENLKAADALVKHISVLAASQDGPMRKVAGYFAEAIARRIYR-RRPLSQVDRALDSP--ALEDLLHL--HFYESC 282
                            689****************************************************.33333222222222..23444444..4***** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                            P+lkf+h+taNqaIlea++g++rvH+iDf++ qGlQWpaLlqaLa Rp+gppslR+Tg+g+p+s+++++l+++g++L  +A+++gv+f
  GSMUA_Achr1P21300_001 283 PYLKFAHFTANQAILEAFSGCRRVHVIDFGMRQGLQWPALLQALALRPGGPPSLRLTGIGPPQSDHSDALQQVGWKLDMLAKTIGVDF 370
                            **************************************************************************************** PP

                   GRAS 177 efnvlvakrledleleeLr 195
                            +++ +va++l+dle ++L 
  GSMUA_Achr1P21300_001 371 RYRGFVASSLADLESRMLL 389
                            **************99984 PP

2GRAS93.63.1e-29432509298374
                   GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            +   gaer+erhetl++Wr r+ +aGF+p++l+++a kqa++ll+ ++ +dg+rvee +g+l+lgW++rpL+++SaWr
  GSMUA_Achr1P21300_001 432 LLEHGAERTERHETLGQWRVRMARAGFEPAHLGSNAFKQASMLLALYAgGDGFRVEETDGCLTLGWHTRPLIATSAWR 509
                            56789************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120413.2E-3347120IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011294.7E-2847126No hitNo description
PROSITE profilePS5098535.983174516IPR005202Transcription factor GRAS
PfamPF035144.2E-63200389IPR005202Transcription factor GRAS
PfamPF035141.1E-26432509IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MKREHQETGA GGGSGYHVAT AADMAGAKGK MTAASSMGME DDDCGVDELL AALGYKVRSS  60
DMADVAQKLE QLEMAMASTA AAASDDASVL PQIASDTVHY DPSHLAAWLD SMLSELNAPP  120
PPLPPPPPPP AITTVAPLRP SDAYGFKPKR KRTCSPSSSS SWGAEAGRAR GSRTEGASSA  180
KPAAALPVVV VDTQETGIRL VHALMACAEA VQQENLKAAD ALVKHISVLA ASQDGPMRKV  240
AGYFAEAIAR RIYRRRPLSQ VDRALDSPAL EDLLHLHFYE SCPYLKFAHF TANQAILEAF  300
SGCRRVHVID FGMRQGLQWP ALLQALALRP GGPPSLRLTG IGPPQSDHSD ALQQVGWKLD  360
MLAKTIGVDF RYRGFVASSL ADLESRMLLE RDGKGAQDGA GGAAADRDGG GGGGEPQRGH  420
VPGSVHGGAA LLLEHGAERT ERHETLGQWR VRMARAGFEP AHLGSNAFKQ ASMLLALYAG  480
GDGFRVEETD GCLTLGWHTR PLIATSAWRV SAASAH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-252004584251GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1530461e-145DQ153046.1 Musa AAB Group GRAS transcription factor (GAI5) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409625.10.0PREDICTED: DELLA protein SLR1-like
SwissprotQ9ST481e-130DWRF8_MAIZE; DELLA protein DWARF8
TrEMBLM0S1T80.0M0S1T8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P21300_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.14e-63GRAS family protein